HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E8R736",
"id": "E8R736_DESM0",
"source_organism": {
"taxId": "765177",
"scientificName": "Desulfurococcus mucosus (strain ATCC 35584 / DSM 2162 / JCM 9187 / O7/1)",
"fullName": "Desulfurococcus mucosus (strain ATCC 35584 / DSM 2162 / JCM 9187 / O7/1)"
},
"name": "Ribonuclease",
"description": [
"Endonuclease that specifically degrades the RNA of RNA-DNA hybrids"
],
"length": 255,
"sequence": "MSAGDTIEIGVDEAGRGPFVGDMVIVGVIGPSRVFESLVSIGLKDSKALEPVARRELFWEILSSNVDIVAWLVSPFTIDRGNMNELEYIRICRILKLLSYSRLARSKPGNSLRIYVDEVKGYGESVRECAMRIYGEHVEVVMEPEADARYPAVSAASVIAKVIRDRNIDVLGKITGGLGSGYPSDPASRAWLATIYGRWDKPPVFIRRSWGIVRDIAPGWHIVKHVKHGRRRSRSLLDFMEGSRHGDESTGRGQG",
"proteome": "UP000001068",
"gene": "Desmu_0150",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004523",
"name": "RNA-DNA hybrid ribonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016070",
"name": "RNA metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "be57e75a8d1d76f6feea61410b1a5573546b0a8f",
"counters": {
"domain_architectures": 28247,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28247
}
}
}