GET /api/protein/UniProt/E8R736/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E8R736",
        "id": "E8R736_DESM0",
        "source_organism": {
            "taxId": "765177",
            "scientificName": "Desulfurococcus mucosus (strain ATCC 35584 / DSM 2162 / JCM 9187 / O7/1)",
            "fullName": "Desulfurococcus mucosus (strain ATCC 35584 / DSM 2162 / JCM 9187 / O7/1)"
        },
        "name": "Ribonuclease",
        "description": [
            "Endonuclease that specifically degrades the RNA of RNA-DNA hybrids"
        ],
        "length": 255,
        "sequence": "MSAGDTIEIGVDEAGRGPFVGDMVIVGVIGPSRVFESLVSIGLKDSKALEPVARRELFWEILSSNVDIVAWLVSPFTIDRGNMNELEYIRICRILKLLSYSRLARSKPGNSLRIYVDEVKGYGESVRECAMRIYGEHVEVVMEPEADARYPAVSAASVIAKVIRDRNIDVLGKITGGLGSGYPSDPASRAWLATIYGRWDKPPVFIRRSWGIVRDIAPGWHIVKHVKHGRRRSRSLLDFMEGSRHGDESTGRGQG",
        "proteome": "UP000001068",
        "gene": "Desmu_0150",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004523",
                "name": "RNA-DNA hybrid ribonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016070",
                "name": "RNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "be57e75a8d1d76f6feea61410b1a5573546b0a8f",
        "counters": {
            "domain_architectures": 28247,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28247
        }
    }
}