HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E8N9U0",
"id": "E8N9U0_MICTS",
"source_organism": {
"taxId": "979556",
"scientificName": "Microbacterium testaceum (strain StLB037)",
"fullName": "Microbacterium testaceum (strain StLB037)"
},
"name": "Pyridoxine/pyridoxamine 5'-phosphate oxidase",
"description": [
"Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP)"
],
"length": 213,
"sequence": "MTENPLAHRLDYTLDELDDAALAASPLALLQRWLADAADLPEPNAMVVSTVDATGSPTSRTVLLRGIDDDGALWFFTNRLSRKGRALAENPRVSILFPWYALQRQVIVLGTATPLPAERDDAYFASRPRGSQLSAWASHQSEAVASRAALEEQMAEVTARFPDDQPVPRPPHWGGYRVDATEFEFWQGRPSRLHDRIVFQREGEGWAGVRRQP",
"proteome": null,
"gene": "pdxH",
"go_terms": [
{
"identifier": "GO:0004733",
"name": "pyridoxamine phosphate oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010181",
"name": "FMN binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008615",
"name": "pyridoxine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016638",
"name": "oxidoreductase activity, acting on the CH-NH2 group of donors",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b1ec9dec797efe48ef99d7dd910cd2ef548f8153",
"counters": {
"domain_architectures": 21075,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 21075
}
}
}