General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E8M2L5",
        "id": "E8M2L5_PHOS4",
        "source_organism": {
            "taxId": "945550",
            "scientificName": "Vibrio sinaloensis DSM 21326",
            "fullName": "Vibrio sinaloensis DSM 21326"
        },
        "name": "HTH-type transcriptional regulator BetI",
        "description": [
            "Repressor involved in choline regulation of the bet genes",
            "Repressor involved in the biosynthesis of the osmoprotectant glycine betaine. It represses transcription of the choline transporter BetT and the genes of BetAB involved in the synthesis of glycine betaine"
        ],
        "length": 200,
        "sequence": "MPKVGMPEIRKPQLVQATMSVIDRVGLHAASISLISKEAGVSTGIINHYFGGKHGLLEETMREILRQLSATITSRLRSIPKHEHLQRINAIIDGNFVGFQAENKVAKTWLAFWSYSMHDPQLKRLQSVNEKRLLSHLKLELKGVLDAEQADLVAFGIASLIDGIWLRGTLNPAGIDAIKAREIINDYLDKQLTFYSKNNN",
        "proteome": null,
        "gene": "betI",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "66725821d7df97a42b393f54e0e54b7da3bfed7f",
        "counters": {
            "domain_architectures": 28426,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 2,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 28426
        }
    }
}