General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E7S4M0",
        "id": "CSN2_STRA8",
        "source_organism": {
            "taxId": "888745",
            "scientificName": "Streptococcus agalactiae (strain ATCC 13813 / DSM 2134 / JCM 5671 / CCUG 4208 / LMG 14694 / NCIMB 701348 / NCTC 8181 / G19)",
            "fullName": "Streptococcus agalactiae (strain ATCC 13813 / DSM 2134 / JCM 5671 / CCUG 4208 / LMG 14694 / NCIMB 701348 / NCTC 8181 / G19)"
        },
        "name": "CRISPR-associated protein Csn2",
        "description": [
            "CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA) (By similarity). Binds dsDNA, binding is disrupted by EGTA"
        ],
        "length": 221,
        "sequence": "MIKINFPILDEPLVLSNATILTIEDVSVYSSLVKHFYQYDVDEHLKLFDDKQKSLKATELMLVTDILGYDVNSAPILKLIHGDLENQFNEKPEVKSMVEKLAATITELIAFECLENELDLEYDEITILELIKVLGVKIETQSDTIFEKCFEIIQVYNYLTKKNLLVFVNSGAYLTKDEVIKLCEYINLMQKSVLFLEPRRLYDLPQYVIDKDYFLIGENMV",
        "proteome": null,
        "gene": "csn2",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d9608d2a887f40e6ca667bf56aa1c535c56f3d24",
        "counters": {
            "domain_architectures": 583,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 583
        }
    }
}