General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E7QG80",
        "id": "STS1_YEASZ",
        "source_organism": {
            "taxId": "764100",
            "scientificName": "Saccharomyces cerevisiae (strain Zymaflore VL3)",
            "fullName": "Saccharomyces cerevisiae (strain Zymaflore VL3) (Baker's yeast)"
        },
        "name": "Tethering factor for nuclear proteasome STS1",
        "description": [
            "Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity)"
        ],
        "length": 318,
        "sequence": "MGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN",
        "proteome": null,
        "gene": "STS1",
        "go_terms": [
            {
                "identifier": "GO:0031144",
                "name": "proteasome localization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0071630",
                "name": "nuclear protein quality control by the ubiquitin-proteasome system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "72965f1933d2651fde1183fc712db980064d3742",
        "counters": {
            "domain_architectures": 2125,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2125
        }
    }
}