General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E7MZ79",
        "id": "E7MZ79_9FIRM",
        "source_organism": {
            "taxId": "749551",
            "scientificName": "Selenomonas artemidis F0399",
            "fullName": "Selenomonas artemidis F0399"
        },
        "name": "Shikimate dehydrogenase (NADP(+))",
        "description": [
            "Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA)"
        ],
        "length": 286,
        "sequence": "MITGRTKLLGVLGAPIEHSLSPVLQNAALRAAGLDYVYVALPVKREALRSAVLGLRDAGVCGFNVTIPFKTEIIAVLDALDEDARRIGAVNTVVVGADGRLTGHNTDAAGFLAGFTACGVSLRGAHAVVFGAGGAARAVLCGLLRAGAAQVSIGVRNLVKGEKLCADFAADGGVRAFRFDDAAFRARLGSADVLVQTTPLGMSPHPEEMPPVDWAVVHPAAFVYDLIYTPAETRFLREAARRGHRCVNGETMLAAQGAEAFFLWTGVRPDLVYMRRVLREALDRRA",
        "proteome": "UP000004633",
        "gene": "aroE",
        "go_terms": [
            {
                "identifier": "GO:0004764",
                "name": "shikimate 3-dehydrogenase (NADP+) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019632",
                "name": "shikimate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a1bf018327d0ba8d57fd2e3df4bf0b3cef5b32ab",
        "counters": {
            "domain_architectures": 7910,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7910
        }
    }
}