General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E6YH93",
        "id": "E6YH93_BARC7",
        "source_organism": {
            "taxId": "696125",
            "scientificName": "Bartonella clarridgeiae (strain CCUG 45776 / CIP 104772 / 73)",
            "fullName": "Bartonella clarridgeiae (strain CCUG 45776 / CIP 104772 / 73)"
        },
        "name": "3-oxoacyl-[acyl-carrier-protein] reductase",
        "description": [
            "Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis"
        ],
        "length": 245,
        "sequence": "MFKLTGRKALVTGASGDIGEAIVRALHAQGVIVGLHGTREERLKEIAVDFCKDVFIFPADLSDRNAIKKLAETAEKEMDGVDIIVNNAGITRDGLFVRMQDQDWDDVLAVNLTAAFTLTRELTYNMMRRRYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKSLAQEVASRNITVNCIAPGFIKSAMTDQLNEKQKEKIMAIIPMKRMGIGQEIASAVVYLASDEAGYVTGQTIHVNGGMAMI",
        "proteome": "UP000009101",
        "gene": "fabG",
        "go_terms": [
            {
                "identifier": "GO:0004316",
                "name": "3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff1cec7cb7eee88f7c3ec2b2277c3a1762c3bf68",
        "counters": {
            "domain_architectures": 518272,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 3,
                "prints": 2,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 518272
        }
    }
}