GET /api/protein/UniProt/E6W5H0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E6W5H0",
"id": "E6W5H0_DESIS",
"source_organism": {
"taxId": "653733",
"scientificName": "Desulfurispirillum indicum (strain ATCC BAA-1389 / DSM 22839 / S5)",
"fullName": "Desulfurispirillum indicum (strain ATCC BAA-1389 / DSM 22839 / S5)"
},
"name": "Pyrroline-5-carboxylate reductase",
"description": [
"Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline"
],
"length": 273,
"sequence": "MYQYQYGFIGSGNMAEAFVRGILQKSATQPQQVLCCDIDPRRLEALAQAFPGIATTNDLADMNACRILLLCVKPAQIAAVCEKLHGLLSSEEHILISVAAGIPMAVLQRHLPGRKVVRAMPNTPALVGAGATGYCVDSTLSESRRREVQELFEAVGVAFELEEKQLDVVTALSGGGPAYICLVTEALADAGVRLGLSRSVAQALAAQTLLGTGSMILQTGEHPAVLREKVCSPGGTTIEGICALEMAAVRGAFAEAVAAAYDKAKLLGEVYNG",
"proteome": "UP000002572",
"gene": "proC",
"go_terms": [
{
"identifier": "GO:0004735",
"name": "pyrroline-5-carboxylate reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055129",
"name": "L-proline biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6d5708f86fae1bd73c51d03ad2752b96a1edc21c",
"counters": {
"domain_architectures": 36407,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"panther": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 36407
}
}
}