HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E6VFH0",
"id": "E6VFH0_RHOPX",
"source_organism": {
"taxId": "652103",
"scientificName": "Rhodopseudomonas palustris (strain DX-1)",
"fullName": "Rhodopseudomonas palustris (strain DX-1)"
},
"name": "Adenosylmethionine-8-amino-7-oxononanoate aminotransferase",
"description": [
"Catalyzes the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only aminotransferase known to utilize SAM as an amino donor"
],
"length": 427,
"sequence": "MSHASPVWHPFTQHAVQGDTPNIVHSEGAWLQADDGRRIFDAISSWWVVTHGHRHPTIIAAIKQQADQLDQIIFAGFTHPPAEQLAQRLVEITPPELAHVFFSDSGSTSVEVGLKMALGYWLHSGESRRRILALEGAYHGDTIGGMSVGERGVFNAPYDPLLFDVSRLPFPRAGAEQATLDALERACRTEAVAALIVEPLVLGAGGMLIYPPWVLAEMARICKAHGVLLIADEVMTGWGRTGSLFACEQASVVPDIACYSKGLTGGSVPLAVTMCRREIFDAHFSTDRRKTFFHSSSYTANPIACAAALANLQVWGSEPVQQRIDDLAAVHARALDRFRGDPRFTNVRQIGTIAAVDLQVGDSGYLADVGPRLYAYFIARGLLVRPLGNTIYLMPPYCSTAAEIDAVYEAIAAAPDVLARSCDVSSL",
"proteome": null,
"gene": "bioA",
"go_terms": [
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004015",
"name": "adenosylmethionine-8-amino-7-oxononanoate transaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009102",
"name": "biotin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "77cca87d6dced57500d02f1f72b680f70c660080",
"counters": {
"domain_architectures": 185394,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 185394
}
}
}