GET /api/protein/UniProt/E6R7Y9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E6R7Y9",
"id": "E6R7Y9_CRYGW",
"source_organism": {
"taxId": "367775",
"scientificName": "Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071)",
"fullName": "Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii)"
},
"name": "5-hydroxyisourate hydrolase",
"description": [
"Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU)"
],
"length": 127,
"sequence": "MSNIRSALLLASSLVLDSSQGKPASGVKVSLQILKAEVLGSSEVTGKMLAEGTTDTDGRCSTLLPPNEKLSPGIYKMVFFTGDYFEARGTETFYPVVEITFNYADPSQHYHIPLLLSPFSYTTYRGS",
"proteome": "UP000007805",
"gene": "CGB_F2260W",
"go_terms": [
{
"identifier": "GO:0033971",
"name": "hydroxyisourate hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006144",
"name": "purine nucleobase metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "37cfea698395c831834d0ac5e8c93d9dfd4537a4",
"counters": {
"domain_architectures": 15261,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15261
}
}
}