GET /api/protein/UniProt/E5R3N5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E5R3N5",
"id": "E5R3N5_ARTGP",
"source_organism": {
"taxId": "535722",
"scientificName": "Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)",
"fullName": "Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)"
},
"name": "Uncharacterized protein",
"description": [
"Putative mitochondrial redox protein which could be involved in the reduction of small toxic molecules"
],
"length": 144,
"sequence": "MFRFHKTLDIITLFHKPTLASSAKALSVLQKASTAIKEGAATSPSGTPLRSSDFELNVTEEPPTTDQLKLIMDYMTSSPLASGGIGVGKPGDLVSGATDKSDAVKKLKENADSFIRPVVVDWNNGKAVVATSESAILKLLSEET",
"proteome": "UP000002669",
"gene": "MGYG_00202",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005739",
"name": "mitochondrion",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cdb919886404d1736ab3353eb4a63fb4bce140ea",
"counters": {
"domain_architectures": 1500,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1500
}
}
}