HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E4ZAV7",
"id": "E4ZAV7_NEIL0",
"source_organism": {
"taxId": "489653",
"scientificName": "Neisseria lactamica (strain 020-06)",
"fullName": "Neisseria lactamica (strain 020-06)"
},
"name": "Aspartate-semialdehyde dehydrogenase",
"description": [
"Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate"
],
"length": 371,
"sequence": "MKVGFVGWRGMVGSVLMQRMKEENDFAHIPEAFFFTTSNVGGAAPDFDQAAKTLLDANNVAELAKMDIIVTCQGGDYTKSVFQALRDSGWNGYWIDAASSLRMKDDAIIVLDPVNRNVIDNGLKNGVKNYIGGNCTVSLMLMALGGLFQNDLVEWATSMTYQAASGAGAKNMRELISGMGAVHAQVADELADPAGSILDIDRKVSDFLRSEDYPKANFGVPLAGSLIPWIDVDLGNGQSKEEWKGGAETNKILGRSGNPTVIDGLCVRIGSMRCHSQALTLKLKKDLPVSEIEAILAGANDWVKVIPNEKEASIRELTPAKVTGTLSVPVGRIRKLGMGGEYISAFTVGDQLLWGAAEPLRRVLRIVLGSL",
"proteome": null,
"gene": "asd",
"go_terms": [
{
"identifier": "GO:0016620",
"name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051287",
"name": "NAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008652",
"name": "amino acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004073",
"name": "aspartate-semialdehyde dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009088",
"name": "L-threonine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009089",
"name": "L-lysine biosynthetic process via diaminopimelate",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009097",
"name": "isoleucine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006520",
"name": "amino acid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f9fead37a78f3f17b34aebdc17f03c19c953c120",
"counters": {
"domain_architectures": 32953,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"ssf": 2,
"pfam": 2,
"smart": 1,
"cathgene3d": 2,
"ncbifam": 2,
"pirsf": 1,
"hamap": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 32953
}
}
}