HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E4X6F8",
"id": "E4X6F8_OIKDI",
"source_organism": {
"taxId": "34765",
"scientificName": "Oikopleura dioica",
"fullName": "Oikopleura dioica (Tunicate)"
},
"name": "DNA sliding clamp PCNA",
"description": [
"This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processivity during elongation of the leading strand"
],
"length": 259,
"sequence": "MFECRLSKAEVLKKVMDALKDLIKEGVWDVTCESFSLQSMDSSHVSLVQVELKSDGFESFRCDKNLALGVNMDTMQKLMKCSVNDDVLTIKAEDDGDLMTILFESQNGDKTSAYEMKLMDLDIEQLGIPDQDYSCVVKMPSGEFQRICRDLSIIGESVNITIVKSGVDFSAKGDIGSAKIHLTESANVDNEKDAVTIEVNEPVNLTFALRYLNFFTKATPLSGQVCLSISPDVPMVVKYEIEDLGSVKYFLAPKIEDDE",
"proteome": "UP000001307",
"gene": "GSOID_T00003167001",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006275",
"name": "regulation of DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030337",
"name": "DNA polymerase processivity factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a97d7b10b1c940cf6f311b1cde9d20a761bdaed3",
"counters": {
"domain_architectures": 5872,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5872
}
}
}