GET /api/protein/UniProt/E4V1P1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E4V1P1",
        "id": "E4V1P1_ARTGP",
        "source_organism": {
            "taxId": "535722",
            "scientificName": "Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)",
            "fullName": "Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)"
        },
        "name": "Endoplasmic reticulum transmembrane protein",
        "description": [
            "May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi"
        ],
        "length": 210,
        "sequence": "MTLYFTLVFVLLVTEMAIFVGLIVPLPFTVKRKLFTFISESPIVAKLQYGMKITFIFILILFIDSVNRVYRVQIELTGFDAANSGHAIGTERMEVQARKFYSQRNMYLCGFTLFLSLILNRTYTMILDILRLEDKVKMYEGDKRAGGKDSAKLAAAGDIGEIGRLKKELKARENDIEALKKQSEGLSREYNKLGDEVSAQNKDNTPKKDR",
        "proteome": "UP000002669",
        "gene": "MGYG_06956",
        "go_terms": [
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005783",
                "name": "endoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e1fb5acc4bf2fae38b611e53761cadba22a9e97d",
        "counters": {
            "domain_architectures": 3897,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3897
        }
    }
}