GET /api/protein/UniProt/E4RIG3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E4RIG3",
        "id": "E4RIG3_HALHG",
        "source_organism": {
            "taxId": "656519",
            "scientificName": "Halanaerobium hydrogeniformans",
            "fullName": "Halanaerobium hydrogeniformans"
        },
        "name": "UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase",
        "description": [
            "Involved in cell wall formation. Catalyzes the final step in the synthesis of UDP-N-acetylmuramoyl-pentapeptide, the precursor of murein"
        ],
        "length": 457,
        "sequence": "MESLTLAQIAEAASGKIIKGKAEIKIKDIVIDSREVKKDDLFIAIIGEINDGHEFIDSAVENGAKAVIVDRQINDYSNLAVIKVDDTTKALQDIAHYYRMKFKDLKIAAITGSVGKTSTKDMIAAVLAQKYKTLKTSGNYNNQIGLPLTLLRLCSKDEFAVLEMGMSGFGEIELLAELARPQIAVITNVGPAHIEQLGSIENVAAAKKELLDSLDKSGTAILNYDNEYTRKMAENFNSKLITFGFSAGADLQVIENKFNKDLNREEFKIIWQGKKLKFYLNKPGKHNIYNALAAIAIGFLNNMNPKGIQDGLSKIDFSDLRMEIKELENGAIVINDSYNANPISVRAALDVLAEMKGKRKIAVLASMLELGKMEKKAHLEIGEYIAKQNIDLLITVGEIAELIAEGAERTAMPVEKIYSFADKASTLKFLKDNLKKDDLLLIKGSRSNQMEKIVAEL",
        "proteome": "UP000007434",
        "gene": "murF",
        "go_terms": [
            {
                "identifier": "GO:0016881",
                "name": "acid-amino acid ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0047480",
                "name": "UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071555",
                "name": "cell wall organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "617c8cb3e9dfe470c831f3c70f49056f5e477a85",
        "counters": {
            "domain_architectures": 78555,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 3,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 78555
        }
    }
}