GET /api/protein/UniProt/E4QS55/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E4QS55",
        "id": "E4QS55_MESH1",
        "source_organism": {
            "taxId": "907287",
            "scientificName": "Mesomycoplasma hyopneumoniae (strain 168)",
            "fullName": "Mesomycoplasma hyopneumoniae (strain 168)"
        },
        "name": "ATP synthase subunit beta",
        "description": [
            "Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits"
        ],
        "length": 471,
        "sequence": "MEKQENVGHIVQIFGPVIDVQFPNEHMPAILSALEVKINDESIIFEVAQHLGEGIVRAIAMSMTYNLSKGLEVYDTRSQISVPVGKQVLSRMFNVLGQPIDGGKPLDSFIKNPIHAKAPTYLEQKATSEILVTGIKVIDLLIPFIKGGKIGLFGGAGVGKTVLVQELINNIASKHGGLSVFAGVGERSREGNDLYFEMKKAGVLDKTALVFGQMNEPPGARMRVALSALTMAEYFRDYENQDVLLFIDNIFRFTQAGSEVSTLLGRIPSTVGYQPTLSTEMGQLQERITSTIRGSITSVQAVYVPADDITDPAPATTFSHLDAKTVLDRGIAALGIYPAVDPLASSSRALEPNIVGKKHYLVAKKVVQILQRFKELQDIIAILGVDELSESDKQVVARARRIRNFLSQPFFVAQKFSGIQGQFIKIQDTVNNFDELLSGKYDNIPEEAFLYVGTIDQALEKAKKMGWSEKN",
        "proteome": null,
        "gene": "atpD",
        "go_terms": [
            {
                "identifier": "GO:0046034",
                "name": "ATP metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1902600",
                "name": "proton transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046933",
                "name": "proton-transporting ATP synthase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015986",
                "name": "proton motive force-driven ATP synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045259",
                "name": "proton-transporting ATP synthase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d079caac124722904c86efe2303dd63e1f2836bb",
        "counters": {
            "domain_architectures": 58128,
            "entries": 27,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "cdd": 3,
                "pfam": 3,
                "smart": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 10
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 58128
        }
    }
}