GET /api/protein/UniProt/E3S2U2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E3S2U2",
"id": "E3S2U2_PYRTT",
"source_organism": {
"taxId": "861557",
"scientificName": "Pyrenophora teres f. teres (strain 0-1)",
"fullName": "Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus)"
},
"name": "Elongin-C",
"description": [
"Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor"
],
"length": 103,
"sequence": "MADNNTTEYVTLVSNDGYEFKLLRSAACIAGTIKKALDPMSGFRENTQNRVDLPTINGVVLEKVCEYLYYSQKHAESKDVSDMDIPPELCLELLIAADYLDGM",
"proteome": "UP000001067",
"gene": "PTT_16690",
"go_terms": [
{
"identifier": "GO:0006511",
"name": "ubiquitin-dependent protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "60040bcbb7198711a6088611935a86324e69d474",
"counters": {
"domain_architectures": 5694,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"smart": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5694
}
}
}