General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E3G1Y9",
        "id": "E3G1Y9_ENTLS",
        "source_organism": {
            "taxId": "701347",
            "scientificName": "Enterobacter lignolyticus (strain SCF1)",
            "fullName": "Enterobacter lignolyticus (strain SCF1)"
        },
        "name": "Cobalt transport protein CbiN",
        "description": [
            "Part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import"
        ],
        "length": 93,
        "sequence": "MKKMLILLAMVIALMILPFFIDHGGEFGGSDGEAESQIQVVAPHYKPWFTPLYEPASGEIESLLFTLQGSLGAAVIFYILGYTKGRQRRDDRA",
        "proteome": "UP000006872",
        "gene": "cbiN",
        "go_terms": [
            {
                "identifier": "GO:0015087",
                "name": "cobalt ion transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006824",
                "name": "cobalt ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009236",
                "name": "cobalamin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3867c326b8dc794d636f5395b1e731069986ed83",
        "counters": {
            "domain_architectures": 2778,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2778
        }
    }
}