GET /api/protein/UniProt/E3G0V5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E3G0V5",
"id": "E3G0V5_ENTLS",
"source_organism": {
"taxId": "701347",
"scientificName": "Enterobacter lignolyticus (strain SCF1)",
"fullName": "Enterobacter lignolyticus (strain SCF1)"
},
"name": "Intermembrane phospholipid transport system ATP-binding protein MlaF",
"description": [
"Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. Responsible for energy coupling to the transport system"
],
"length": 270,
"sequence": "MSQTLANLVDVQNMSFSRGQRTIFDNISLSVPRGKITAIMGPSGIGKTTLLRLIGGQIPPDSGEILFDGENVPEMSRSRLYAVRKRMSMLFQSGALFTDMNVFDNVAYPLREHTRLPPPLLKSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAIALEPDLIMFDEPFVGQDPITMGVLVKLISELNSALGVTCIVVSHDVPEVLSIADYAYIVADKKIVAHGSAQSLKVNDDPRVRQFLDGIADGPVPFRYPAGDYRRDLLGTGS",
"proteome": "UP000006872",
"gene": "Entcl_0501",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016887",
"name": "ATP hydrolysis activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "48e3bc51d04b3fd112e2624fb984e1b2e9042b86",
"counters": {
"domain_architectures": 1059062,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"profile": 1,
"pfam": 1,
"smart": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1059062
}
}
}