GET /api/protein/UniProt/E2NAI9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E2NAI9",
"id": "E2NAI9_9BACE",
"source_organism": {
"taxId": "537012",
"scientificName": "Bacteroides cellulosilyticus DSM 14838",
"fullName": "Bacteroides cellulosilyticus DSM 14838"
},
"name": "Diadenylate cyclase",
"description": [
"Catalyzes the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP), a second messenger used to regulate differing processes in different bacteria"
],
"length": 254,
"sequence": "MFFDIGVKDIIDVLLVAFLLYYTYKLMKASGSINVFTGILIFILIWLVVSQVLEMKLLGSIFDKLVSVGVVALIILFQDEIRRFLLTLGSHQHASALVRFFTGNKKENMQHDEIMPVVMACISMGKQKVGALIVIEHNFPLDDVVRTGEVINADINQRLIENIFFKNSPLHDGAMVISKGRIKAAGCILPVSHNLDIPKELGLRHRAAMGISQESDALAIIVSEETGSISVAYKGQFHLRLNAEELESLLTKEN",
"proteome": null,
"gene": "dacA",
"go_terms": [
{
"identifier": "GO:0004016",
"name": "adenylate cyclase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006171",
"name": "cAMP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2126d3d652f43dc84828eefba7a5b3a6c52f9eca",
"counters": {
"domain_architectures": 7364,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"cathgene3d": 1,
"pfam": 2,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 7364
}
}
}