HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E2C3T2",
"id": "E2C3T2_HARSA",
"source_organism": {
"taxId": "610380",
"scientificName": "Harpegnathos saltator",
"fullName": "Harpegnathos saltator (Jerdon's jumping ant)"
},
"name": "NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial",
"description": [
"Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I"
],
"length": 470,
"sequence": "MASAIVRCFQIPRRQLGLLGSSLSSQQQQRAFANAAPEGKKQGSPLSDQDRIFTNLYGRHDWRLKGAISRGDWHKTKEILDKGADWIINEIKVSGLRGRGGAGFPSGMKWSFMNKPSDGRPKYLVINADEGEPGTCKDREILRHDPHKLVEGCLIAGRAMGACAAYIYIRGEFYNEASNMQVAIAEAYQAGLIGKNACNSGYNFDIFVQRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGLFGCPTTVTNVETVAVAPTICRRSGAWFASFGRPRNHGTKLFNISGHVNKPCTVEEEMSIPLKELIERHAGGVIGGWDNLMGVIPGGSSTPVIPKSVCDTVLLDFDDLIRVQSSFGTAAVIVMNKQTDIIKAITRLISFYKHESCGQCTPCREGISWMYKILKRFVEGNAEMHEIDMLWELTKQIELHTICALADGAAWPVQGLIRHFRPEIEARMKQQKEVAFS",
"proteome": "UP000008237",
"gene": "EAI_14447",
"go_terms": [
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010181",
"name": "FMN binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051287",
"name": "NAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008137",
"name": "NADH dehydrogenase (ubiquinone) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ed25c434cff0d6e1c55704386e40a03d8e298a79",
"counters": {
"domain_architectures": 8316,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 3,
"pfam": 3,
"cathgene3d": 3,
"smart": 1,
"panther": 1,
"ncbifam": 2,
"prosite": 2,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8316
}
}
}