GET /api/protein/UniProt/E2BV18/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E2BV18",
        "id": "E2BV18_HARSA",
        "source_organism": {
            "taxId": "610380",
            "scientificName": "Harpegnathos saltator",
            "fullName": "Harpegnathos saltator (Jerdon's jumping ant)"
        },
        "name": "Autophagy protein 5",
        "description": [
            "Involved in autophagic vesicle formation",
            "May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. Plays a crucial role in IFN-gamma-induced autophagic cell death by interacting with FADD"
        ],
        "length": 265,
        "sequence": "MANDREMLREIWDGKIPVCFTLDSEETCELQGPDPFYLMVPRLSYFPLCTEKVKKHFIRHIQSDSKQEHEMWLEFNGIPLKWHYPIGVLLDIYFNDIQLPWNIVVHFDKFPENVLMHCQNKEVVEAHFLSCIKEADVLKHRGQIVSSMQKKDHTQLWNGIMNDKFDQFWSVNGRLMEAITEEGFKYIPFRCYTSEDKYIQKLVRPINEEGQRKTLKHLLSEVFPDQESVTVRTHGIIPPLETPLQWMAEHLSYPDNFLHLIVVTS",
        "proteome": "UP000008237",
        "gene": "EAI_15918",
        "go_terms": [
            {
                "identifier": "GO:0006914",
                "name": "autophagy",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ee45ca3a0a493d768009ea02f61d26e83a4b9f11",
        "counters": {
            "domain_architectures": 3776,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "cathgene3d": 3,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3776
        }
    }
}