GET /api/protein/UniProt/E1CJK0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E1CJK0",
"id": "LIP2_MALFU",
"source_organism": {
"taxId": "55194",
"scientificName": "Malassezia furfur",
"fullName": "Malassezia furfur (Pityriasis versicolor infection agent)"
},
"name": "Secreted triacylglycerol lipase LIP2",
"description": [
"Secreted lipase that hydrolyzes acylglycerol lipids such as triacylglycerols and consequently releases free fatty acid (By similarity). Due to an absence of fatty acid synthase genes in Malassezia species, secretory lipases are essential for the yeast to generate free fatty acids from degradation of sebum and assimilate them as lipid sources for growth (Probable). Plays important roles not only in lipid metabolism but also in the immune response of host cells and pathogenesis (Probable)"
],
"length": 468,
"sequence": "MFGFRLFILAAVALAYIQCAAARMTVAHRLGARSLPTPENDPFYTPDDGWESAAPGTILKKREITVANSGVFQYGVRGFQLLYRTSGVNRGDASHTVTTVIIPENYDKDKLVSANMYEDSYSSNCAPSYSMRKGSKVFNDLANSYQMLFITTLLHEGWAVTVPDHEGPNNAFTSGRVEGHAILDGIRATLNYKKLGLNSDAKVIGYGYSGGALATGWAASLHSQYAHELNVAGWSMGGTVSNVTEWLGYIDNTTGAGFALASLGGLSSSYSELAWVQDNLTSKGRRLLDQSAQNCMYQNLWAVGKQKILDDSVFAGGSTFLQNDGALNILNKLTLGRFSKFVPIAPVFMFHATHDEVVPFNMAITTADAWCAQGAQIKFLSNTGSEMEHTNTELFNLPNVIFFMRDRFKGKDFGGQCQYPSSNDPWFNPQILGTSAAIYLQQVLDLIGNRIGGHDSILWDKVHSKQQP",
"proteome": null,
"gene": "LIP2",
"go_terms": [
{
"identifier": "GO:0004806",
"name": "triacylglycerol lipase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016042",
"name": "lipid catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d56066ea269824d91c19e885150553b01d3f2dcd",
"counters": {
"domain_architectures": 12810,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 12810
}
}
}