GET /api/protein/UniProt/E1AND9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E1AND9",
"id": "E1AND9_BPPHX",
"source_organism": {
"taxId": "10847",
"scientificName": "Escherichia phage phiX174",
"fullName": "Escherichia phage phiX174"
},
"name": "Major spike protein G",
"description": [
"Attaches the circulating virion to the bacterial lipopolysaccharides which serve as receptor for the virus. Determines the phage host-range. Probably triggers with protein H the injection of the phage DNA into the host cytoplasm upon conformational changes induced by the interaction with host lipopolysaccharides"
],
"length": 175,
"sequence": "MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFPHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0044003",
"name": "symbiont-mediated perturbation of host process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "7e15ddb7e9d56471961094c141a4516aa9400cff",
"counters": {
"domain_architectures": 261,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cathgene3d": 1,
"pirsf": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 261
}
}
}