GET /api/protein/UniProt/E1AND9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E1AND9",
        "id": "E1AND9_BPPHX",
        "source_organism": {
            "taxId": "10847",
            "scientificName": "Escherichia phage phiX174",
            "fullName": "Escherichia phage phiX174"
        },
        "name": "Major spike protein G",
        "description": [
            "Attaches the circulating virion to the bacterial lipopolysaccharides which serve as receptor for the virus. Determines the phage host-range. Probably triggers with protein H the injection of the phage DNA into the host cytoplasm upon conformational changes induced by the interaction with host lipopolysaccharides"
        ],
        "length": 175,
        "sequence": "MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFPHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0044003",
                "name": "symbiont-mediated perturbation of host process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "7e15ddb7e9d56471961094c141a4516aa9400cff",
        "counters": {
            "domain_architectures": 261,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 261
        }
    }
}