GET /api/protein/UniProt/E1A830/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E1A830",
"id": "E1A830_ARATH",
"source_organism": {
"taxId": "3702",
"scientificName": "Arabidopsis thaliana",
"fullName": "Arabidopsis thaliana (Mouse-ear cress)"
},
"name": "Auxin-responsive protein",
"description": [
"Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations"
],
"length": 185,
"sequence": "MYCSDPPHPLHLVASDKQQKDHKLILSWKKPTMDSDPHGVFPNSPKYHPYYSQTTEFGGVIDLGLSLRTIQHEIYHSSGQRYCSNEGYRRKWGYVKVTMDGFVVGRKVCVLDHGSYSTLAHQLEDMFGMQSVSGLRLFQMESKFCLVYRDEEGLWRNAGDVPWNEFIESVERLRITRRNDAVLPF",
"proteome": null,
"gene": "IAA34",
"go_terms": [
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ba825921e6257b43e02eadfb8e6ce84e87ccbf2",
"counters": {
"domain_architectures": 15378,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15378
}
}
}