GET /api/protein/UniProt/E1A195/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E1A195",
        "id": "E1A195_9CAUD",
        "source_organism": {
            "taxId": "879628",
            "scientificName": "Aeromonas phage phiAS4",
            "fullName": "Aeromonas phage phiAS4"
        },
        "name": "Late transcription coactivator",
        "description": [
            "Activates transcription at late promoters when the sliding clamp is present. Binds to both the host RNA polymerase (RNAP) and the upstream dsDNA"
        ],
        "length": 84,
        "sequence": "MSNPNNLNDKTANGIEIENLVKTGLTYLEACVQWLEENSLEINSCHKYIPRAVIDKLSKECVDSDMLRPSIAKSMTRNSLDFLM",
        "proteome": "UP000002235",
        "gene": "phiAS4_ORF0047",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "67d0d925b10b09fe1e818573c653826549d9cbc4",
        "counters": {
            "domain_architectures": 577,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 577
        }
    }
}