General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E0W3F5",
        "id": "E0W3F5_PEDHC",
        "source_organism": {
            "taxId": "121224",
            "scientificName": "Pediculus humanus subsp. corporis",
            "fullName": "Pediculus humanus subsp. corporis (Body louse)"
        },
        "name": "EF-hand domain-containing protein",
        "description": [
            "Calcineurin is a calcium-binding and calmodulin-binding protein found in all cells from yeast to mammals, and a calcium-dependent, calmodulin-stimulated protein phosphatase"
        ],
        "length": 162,
        "sequence": "MELCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKESKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTILFADKDEDGKINFEEFCNVVGNTDIHKKMVVDV",
        "proteome": "UP000009046",
        "gene": "8237040",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4403894abd2a553d27123253401701775ffd4bde",
        "counters": {
            "domain_architectures": 58144,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 58144
        }
    }
}