GET /api/protein/UniProt/E0J4Y2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E0J4Y2",
"id": "E0J4Y2_ECOLW",
"source_organism": {
"taxId": "566546",
"scientificName": "Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)",
"fullName": "Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)"
},
"name": "DNA polymerase III subunit theta",
"description": [
"DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity",
"The exact function of the theta subunit is unknown"
],
"length": 76,
"sequence": "MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK",
"proteome": null,
"gene": "holE",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003887",
"name": "DNA-directed DNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ec461ba33a8f2c651f66aaa9af2ef1b6d34acdea",
"counters": {
"domain_architectures": 1814,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1814
}
}
}