GET /api/protein/UniProt/D9TK32/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D9TK32",
        "id": "D9TK32_CALOO",
        "source_organism": {
            "taxId": "608506",
            "scientificName": "Caldicellulosiruptor obsidiansis (strain ATCC BAA-2073 / JCM 16842 / OB47)",
            "fullName": "Caldicellulosiruptor obsidiansis (strain ATCC BAA-2073 / JCM 16842 / OB47)"
        },
        "name": "Probable transaldolase",
        "description": [
            "Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway"
        ],
        "length": 221,
        "sequence": "MLSKMKLFIDTANVNEIREAHSWGIICGVTTNPSLIAKEGRDFKEVVNEICSIVDGPISAEVISLKAEGMIEEAKDLAKIHKNIVIKIPMTAEGLKAVSVLSKEGIKTNVTLIFSAAQALLAAKAGATYVSPFVGRLDDIGQNGIELIKEIVQIFKNYPDIKTEIIAASIRHPIHVIEAAKAGAHIATVPFKVLEQMTKHALTDVGIERFLKDWEKVPKKS",
        "proteome": "UP000000347",
        "gene": "tal",
        "go_terms": [
            {
                "identifier": "GO:0016832",
                "name": "aldehyde-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004801",
                "name": "transaldolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d17969bf9c4e40985b3969fe5953a412ee859b50",
        "counters": {
            "domain_architectures": 37554,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37554
        }
    }
}