GET /api/protein/UniProt/D9QTV8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D9QTV8",
"id": "D9QTV8_ACEAZ",
"source_organism": {
"taxId": "574087",
"scientificName": "Acetohalobium arabaticum (strain ATCC 49924 / DSM 5501 / Z-7288)",
"fullName": "Acetohalobium arabaticum (strain ATCC 49924 / DSM 5501 / Z-7288)"
},
"name": "UDP-3-O-acyl-N-acetylglucosamine deacetylase",
"description": [
"Catalyzes the hydrolysis of UDP-3-O-myristoyl-N-acetylglucosamine to form UDP-3-O-myristoylglucosamine and acetate, the committed step in lipid A biosynthesis"
],
"length": 282,
"sequence": "MHIDSKRQQTIKQEITYTGTGLHTGNQQITITCKPLTANSGIRFKRTDLPSAPEIEAVVDNIVSTKRSTSLGTDQWQISTVEHLLAALNGLKIDNLLIEIDAGEVPITDGSSLVFTELLQKAGIKQQNKKCEIHAIEEAVWAREGDTYLVALPGPELKITYTFVSDHPAVGNQFGEFTIDEKTFINQIAPSRTFGFASEIEALQEEGLALGGSLDNAVLIGEEEIVNELRFEDEIVRHKILDIIGDLALIKPFRGHIIAVRSGHALNRRLAHKIKQQVMHCW",
"proteome": "UP000001661",
"gene": "lpxC",
"go_terms": [
{
"identifier": "GO:0103117",
"name": "UDP-3-O-acyl-N-acetylglucosamine deacetylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009245",
"name": "lipid A biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8045144b91c2acf5e3b3d9f87a32692b4dcb71e0",
"counters": {
"domain_architectures": 11871,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11871
}
}
}