General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D9Q084",
        "id": "D9Q084_ACIS3",
        "source_organism": {
            "taxId": "666510",
            "scientificName": "Acidilobus saccharovorans (strain DSM 16705 / JCM 18335 / VKM B-2471 / 345-15)",
            "fullName": "Acidilobus saccharovorans (strain DSM 16705 / JCM 18335 / VKM B-2471 / 345-15)"
        },
        "name": "Glycerol-1-phosphate dehydrogenase [NAD(P)+]",
        "description": [
            "Catalyzes the NAD(P)H-dependent reduction of dihydroxyacetonephosphate (DHAP or glycerone phosphate) to glycerol 1-phosphate (G1P). The G1P thus generated is used as the glycerophosphate backbone of phospholipids in the cellular membranes of Archaea"
        ],
        "length": 353,
        "sequence": "MEQHIIELPKRIVVGEGALKSLGGHFRDMFPSGSLVFVVTGPHIINSLYNDVKQILEDNGFSVTYTIAGPATVDEANRVAEEAKRDRADVLLGLGGGRSIDLAKYAAAESGKEFVSVPTAPSHDGITSPFATLRGFERPYSKLAKPPRLLLLDIDVISSAPKRLASAGFGDLIGKYTAVLDWRLAHNLRGEYYGAYAASLALMSARHVGAYARKIGLGSKDGIRALVEALVSSGVAMCIAGSSRPASGSEHLFAHALEMISKRPPLHGEAVGVGTILMSYLYGKDWVRIRRLLKEAGAPVNARELGVTDDEVIEALVKAASIRPERYTILGEKGLTRDAAEELATKTKVINGD",
        "proteome": "UP000000346",
        "gene": "egsA",
        "go_terms": [
            {
                "identifier": "GO:0016614",
                "name": "oxidoreductase activity, acting on CH-OH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050492",
                "name": "glycerol-1-phosphate dehydrogenase [NAD(P)+] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "492bbba9ce2f448f6f258f5190540fe964befae6",
        "counters": {
            "domain_architectures": 4409,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4409
        }
    }
}