General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D9IG03",
        "id": "D9IG03_9MURI",
        "source_organism": {
            "taxId": "69075",
            "scientificName": "Rattus losea",
            "fullName": "Rattus losea (lesser rice-field rat)"
        },
        "name": "LARGE-2",
        "description": [
            "Bifunctional glycosyltransferase with both alpha-1,3-xylosyltransferase and beta-1,3-glucuronyltransferase activities involved in the maturation of alpha-dystroglycan (DAG1) by glycosylation leading to DAG1 binding to laminin G-like domain-containing extracellular proteins with high affinity and in a phosphorylated-O-mannosyl trisaccharide dependent manner. Elongates the glucuronyl-beta-1,4-xylose-beta disaccharide primer structure by adding repeating units [-3-Xylose-alpha-1,3-GlcA-beta-1-] to produce a heteropolysaccharide. Supports the maturation of DAG1 more effectively than LARGE1. In addition, can modify both heparan sulfate (HS)- and chondroitin/dermatan sulfate (CS/DS)-proteoglycans (PGs), namely GPC4, with a glycosaminoglycan (GAG)-like polysaccharide composed of xylose and glucuronic acid to confer laminin binding"
        ],
        "length": 654,
        "sequence": "ALQLLLLLVVFFFLVRQPPEYGRGTTPTDEGEPWGSRSCSTFIQQLLLPTKCEMLHVAIVCAGYNSSREIITLMKSVLFYRKNPLHLHLITDAVARNILETLFRTWMVPAVVVSFYDAEELKPLVSWIPNKHYSGLYGLMKLVLPSVLPLSLTRVIVLDTDVTFSSDIMELWALFGHFSDKQVVGLVENQSDWYLGNLWKNHRPWPALGRGFNTGVILLWLDRLQQIGWEQMWKLTAKRELLTLTATSLADQDIFNAVIKEHPELVHPLPCVWNVQLSDHTLAERCYLEAADLKVIHWNSPKKLRVKNKHAEFFRDLHLTFLGFDGKLLCRELFGCPNQFPPGAEQLQQALAQLDEEEPCFEFRQQQLTVHRVHITFLSHQPPPPRPHDVTLVAQLSMDRLQMLEALCRHWRGPMSLALYLTDAEAQQFLRFVETSPVLSARKDVAYHVVYRDGPLYPVNQLRNVALAQALTPYVFLSDIDFLPAYSLYDYLRASIEQLALGRRQRKAALVVPAFETLHYRFSFPNSKAELLTLLDAGSLHTFRYHEWPQGHASTDYTRWREAQAPYRVQWSADYEPYVVVPRDCPRYDPRFVGFGWNKVAHIIELDAQEYEFLVLPEAFSIHLPHAPSLDISRFRSSPTYRDCLQALKEEFHQ",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0016757",
                "name": "glycosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bdfcf100d7a7cc1df9326a3a01ad4f94fc9bfa73",
        "counters": {
            "domain_architectures": 681,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 681
        }
    }
}