General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D8SPS8",
        "id": "D8SPS8_SELML",
        "source_organism": {
            "taxId": "88036",
            "scientificName": "Selaginella moellendorffii",
            "fullName": "Selaginella moellendorffii (Spikemoss)"
        },
        "name": "Queuosine 5'-phosphate N-glycosylase/hydrolase",
        "description": [
            "Catalyzes the hydrolysis of queuosine 5'-phosphate, releasing the nucleobase queuine (q). Is required for salvage of queuine from exogenous queuosine (Q) that is imported and then converted to queuosine 5'-phosphate intracellularly"
        ],
        "length": 322,
        "sequence": "MADHGERNAVAAPFSSLAVRSSTEWVADHASHVSIDPAGIAKVVDSLHGDLPAVSWDFEGIHYFDGGPLTAQYLLVLDTLNFCFWPDGDLHYDHLAAGLKRALQRDNSIFDAKSLKSFTGIQLRELLEWPRPLPLEDERARLLAEVGTELERSFDGQAVNLILAASGSAVALVELVAMHFPGFRDHSVYKGHQVFLYKRAQIFVADLWGAFKGQGLGAFADIAAITMFADYIVPAVLRQWGILNYSPKLARIVDNLEELSSGTEEEIEIRACTIAAVEMLREKLRSKAGKERMHKLVLDQSDLRYSLQCRGSAYHPARPPVL",
        "proteome": "UP000001514",
        "gene": "SELMODRAFT_446244",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c91405e1c1dc315cf38bead4f6eca0d8402cccca",
        "counters": {
            "domain_architectures": 4417,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4417
        }
    }
}