HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D7VRL3",
"id": "D7VRL3_SPHSI",
"source_organism": {
"taxId": "525373",
"scientificName": "Sphingobacterium spiritivorum ATCC 33861",
"fullName": "Sphingobacterium spiritivorum ATCC 33861"
},
"name": "Recombination protein RecR",
"description": [
"May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO"
],
"length": 204,
"sequence": "MEFSSKLLQQAVDEFGRLPGIGQKTALRLVLHLLKQSDGEVLRFTGALNQLKEQIKYCKECFNISDHDICEICSSLKRDKSLICVVEDTRDVMAIENTNQYQGVYHVLGGLISPMDGVGPSDLKIEGLVQRLRSGHVKEVILALSATMEGDTTIFYLYRKLKEFDIQISTIARGIAFGGELEYVDEITLGRSIATRVPYERNIG",
"proteome": "UP000006258",
"gene": "recR",
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006310",
"name": "DNA recombination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ce01ad59a6925878e860e8dcc06379ca41da7ed2",
"counters": {
"domain_architectures": 21330,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 4,
"ssf": 1,
"pfam": 4,
"smart": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 21330
}
}
}