General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D7REY5",
        "id": "CDHC_PSEU3",
        "source_organism": {
            "taxId": "765715",
            "scientificName": "Pseudomonas sp. (strain CBB1)",
            "fullName": "Pseudomonas sp. (strain CBB1)"
        },
        "name": "Caffeine dehydrogenase subunit gamma",
        "description": [
            "Component of the caffeine dehydrogenase complex that catalyzes the hydrolytical oxidation of 1,3,7-trimethylxanthine (caffeine) by incorporation of an oxygen atom originating from a water molecule into position C-8 to produce 1,3,7-trimethyluric acid (TMU). Coenzyme Q0 (ubiquinone-0) is the preferred electron acceptor and, to a lesser extent, coenzyme Q2 (ubiquinone-2) can also be used, but oxygen and NAD(P)(+) cannot. Is involved in a caffeine degradation pathway that allows Pseudomonas sp. strain CBB1 to grow on caffeine as the sole carbon and nitrogen source. Is also active with theobromine as substrate, but shows a very poor activity with theophylline and is not active with xanthine, 3-methylxanthine, 7-methylxanthine, TMU, and 3,7-dimethylurate"
        ],
        "length": 167,
        "sequence": "MSSHVISLTVNGQAIERKVDSRTLLADFLRDELRLTGTHVGCEHGVCGACTIQFDGEPARSCLMLAVQAEGHSIRTVEALAVDGCLGALQQAFHEKHGLQCGFCTPGLLMTLDYALTADLHIDFSSDKEIRELISGNLCRCTGYQNIINAIKSVSPTTEIAKSEELV",
        "proteome": null,
        "gene": "cdhC",
        "go_terms": [
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051537",
                "name": "2 iron, 2 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eeee4871250ddb15b10e78e27dcb3364932ef337",
        "counters": {
            "domain_architectures": 39705,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 39705
        }
    }
}