HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D7MFE0",
"id": "D7MFE0_ARALL",
"source_organism": {
"taxId": "81972",
"scientificName": "Arabidopsis lyrata subsp. lyrata",
"fullName": "Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)"
},
"name": "Peroxidase",
"description": [
"Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue"
],
"length": 312,
"sequence": "MRAITALFFLFCFVAPSALAQLRQGFYGRSCPRAESIVANVVASRFRRDRSITAAFLRMQFHDCFVRGCDASLLIDPRPGRPSEKSTGPNASVRGYEVIDEAKRQLEAACPRTVSCADIVTLATRDSVALAGGPRYSVPTGRRDGLRSNPGDVNLPGPTIPVSASIQLFAAQGMNTNDMVTLIGGGHSVGVAHCSLFRDRLADPAMDRSLNARLRNTCRAPNDPTVFLDQRTPFTVDNAIYGEIRRQRGILRIDQNLGLSGSTRGIVSSFASSNTLFRQRFAQAMVKMGTIRVLTGRSGEIRRNCRLFNNGR",
"proteome": "UP000008694",
"gene": "ARALYDRAFT_913963",
"go_terms": [
{
"identifier": "GO:0004601",
"name": "peroxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042744",
"name": "hydrogen peroxide catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006979",
"name": "response to oxidative stress",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "14f0affbad7d6f2240b4fb0cbb503bfe9b0e92c5",
"counters": {
"domain_architectures": 59418,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"profile": 1,
"ssf": 1,
"cathgene3d": 2,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 59418
}
}
}