GET /api/protein/UniProt/D7FFF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D7FFF4",
        "id": "D7FFF4_HELP3",
        "source_organism": {
            "taxId": "693745",
            "scientificName": "Helicobacter pylori (strain B8)",
            "fullName": "Helicobacter pylori (strain B8)"
        },
        "name": "Beta-lactamase",
        "description": [
            "Hydrolyzes 6-aminopenicillinic acid and 7-aminocephalosporanic acid (ACA) derivatives",
            "Slowly hydrolyzes 6-aminopenicillinic acid and 7-aminocephalosporanic acid (ACA) derivatives. May be involved in the synthesis of the cell wall peptidoglycan"
        ],
        "length": 250,
        "sequence": "MLGSVKKTLFGVLCLGALCLRGLMAEPDAKELVNLGIESAKKQDFAQAKTHFEKACELKNGFGCVFLGAFYEEGKGVGKDLKKAIQFYTKGCELNDGYGCNLLGNLYYNGQGVSKDAKKASQYYSKACDLNHAEGCMVLGSLHHYGVGTHKDLRKALDLYEKACDLKDSPGCINAGYIYSITKNFKEAIVRYSKACELKDGRGCYNLGVMQYNAQGTAKDEKQAVENFKKGCKSSVKEACDALKELKIEL",
        "proteome": null,
        "gene": "hcpA",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f6f4af627e2af7efd015d93bbd275c36eb7c08c8",
        "counters": {
            "domain_architectures": 6,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 2,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6
        }
    }
}