GET /api/protein/UniProt/D7FFF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D7FFF4",
"id": "D7FFF4_HELP3",
"source_organism": {
"taxId": "693745",
"scientificName": "Helicobacter pylori (strain B8)",
"fullName": "Helicobacter pylori (strain B8)"
},
"name": "Beta-lactamase",
"description": [
"Hydrolyzes 6-aminopenicillinic acid and 7-aminocephalosporanic acid (ACA) derivatives",
"Slowly hydrolyzes 6-aminopenicillinic acid and 7-aminocephalosporanic acid (ACA) derivatives. May be involved in the synthesis of the cell wall peptidoglycan"
],
"length": 250,
"sequence": "MLGSVKKTLFGVLCLGALCLRGLMAEPDAKELVNLGIESAKKQDFAQAKTHFEKACELKNGFGCVFLGAFYEEGKGVGKDLKKAIQFYTKGCELNDGYGCNLLGNLYYNGQGVSKDAKKASQYYSKACDLNHAEGCMVLGSLHHYGVGTHKDLRKALDLYEKACDLKDSPGCINAGYIYSITKNFKEAIVRYSKACELKDGRGCYNLGVMQYNAQGTAKDEKQAVENFKKGCKSSVKEACDALKELKIEL",
"proteome": null,
"gene": "hcpA",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f6f4af627e2af7efd015d93bbd275c36eb7c08c8",
"counters": {
"domain_architectures": 6,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 2,
"ssf": 1,
"pfam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6
}
}
}