HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D7F9L8",
"id": "D7F9L8_DROME",
"source_organism": {
"taxId": "7227",
"scientificName": "Drosophila melanogaster",
"fullName": "Drosophila melanogaster (Fruit fly)"
},
"name": "Odorant receptor 94b",
"description": [
"Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability"
],
"length": 365,
"sequence": "LLVIQRWIGLLKWENEGEDGVLTWLKRIYPFVLHLSLTFTYIALMWYEAITSSDFEEAGQVLYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPFEWRTRERYFYAWGYNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEVLKNAAEEKARPELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFAL",
"proteome": null,
"gene": "or94b",
"go_terms": [
{
"identifier": "GO:0004984",
"name": "olfactory receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005549",
"name": "odorant binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007608",
"name": "sensory perception of smell",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7d03dbc560b58b70418a0fe0fcab10f704180c2a",
"counters": {
"domain_architectures": 28111,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 28111
}
}
}