HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D7DRW5",
"id": "D7DRW5_METV3",
"source_organism": {
"taxId": "456320",
"scientificName": "Methanococcus voltae (strain ATCC BAA-1334 / A3)",
"fullName": "Methanococcus voltae (strain ATCC BAA-1334 / A3)"
},
"name": "Small ribosomal subunit protein uS4",
"description": [
"With S5 and S12 plays an important role in translational accuracy",
"One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit"
],
"length": 177,
"sequence": "MGDPRRLSKKYDTPNHPWIGERINKERDLSQKYGLINKKELWKMETQLRNYRRQARKLISNTTAQGVKEAIQLFAVLKRYGILNEQEPTLDHVLSLNIENILDRRLQTIVYEKGLARTPKQARQFIVHGHIAVNGRKVSSPSYLVELEESDAISYVGISPLAAENHPERAKAVEEKQ",
"proteome": "UP000007722",
"gene": "rps4",
"go_terms": [
{
"identifier": "GO:0019843",
"name": "rRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015935",
"name": "small ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e2ef8307f6c8b472fa144fb8a66a56865a92d873",
"counters": {
"domain_architectures": 19596,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 2,
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"profile": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19596
}
}
}