GET /api/protein/UniProt/D6ZKT6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D6ZKT6",
        "id": "D6ZKT6_MOBCV",
        "source_organism": {
            "taxId": "548479",
            "scientificName": "Mobiluncus curtisii (strain ATCC 43063 / DSM 2711 / V125)",
            "fullName": "Mobiluncus curtisii (strain ATCC 43063 / DSM 2711 / V125)"
        },
        "name": "Large ribosomal subunit protein uL1",
        "description": [
            "Protein L1 is also a translational repressor protein, it controls the translation of the L11 operon by binding to its mRNA",
            "Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release"
        ],
        "length": 229,
        "sequence": "MKHAKKYNEAAKKILPDTLYPIDDAFKLVKDTSPVKFDATVEVAMRLNVDPRKADQMVRGTVSLPHGTGKTARVLVFAVGDKAADAEAAGADEVGGDELIEKVSKGYTDFDVAVATPDLMGKVGRLGKVLGPRGLMPNPKTGTVTMDVAKAVKDIKGGRIEFRVDKHANLQFIVGKCSFEPAKLAENFRAVLEEVQRLRPSTIKGRYITKVSISTTMGPSIPLSLATKE",
        "proteome": "UP000006742",
        "gene": "rplA",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015934",
                "name": "large ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5e3872cf7d15195ea5cee583d7e6bb081fb5cc1e",
        "counters": {
            "domain_architectures": 42125,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 42125
        }
    }
}