General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D6CQC3",
        "id": "D6CQC3_THIA3",
        "source_organism": {
            "taxId": "426114",
            "scientificName": "Thiomonas arsenitoxydans (strain DSM 22701 / CIP 110005 / 3As)",
            "fullName": "Thiomonas arsenitoxydans (strain DSM 22701 / CIP 110005 / 3As)"
        },
        "name": "Flagellar L-ring protein",
        "description": [
            "Assembles around the rod to form the L-ring and probably protects the motor/basal body from shearing forces during rotation"
        ],
        "length": 237,
        "sequence": "MTAMSFLRSDSHRLRLLLAAAFALLLGACATAPQHLSSGSLKPLPIPAEPESMNAHTPNGAIWQPGTNVSLFEDSRAHRVGDLITVLIQENANATKSTNTTVNKSDDVSAGLSSFFGKPFTVGGYSPSMGLTSSTKFGGNGATSQSNTFTTTLQATVVQVMSNGNMQISGQKEVMLNGGHEYIRVAGVVRAADVSPQNTVLSTQIANARVEYSGTGDVYAAAKVPWLASFFLSLWPF",
        "proteome": "UP000078599",
        "gene": "flgH",
        "go_terms": [
            {
                "identifier": "GO:0003774",
                "name": "cytoskeletal motor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071973",
                "name": "bacterial-type flagellum-dependent cell motility",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009427",
                "name": "bacterial-type flagellum basal body, distal rod, L ring",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "44fdc3b3f68562865f6b24a4851551d6db42a5b7",
        "counters": {
            "domain_architectures": 10422,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10422
        }
    }
}