HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D5IG34",
"id": "D5IG34_9EURO",
"source_organism": {
"taxId": "747538",
"scientificName": "Hamigera terricola",
"fullName": "Hamigera terricola"
},
"name": "DNA replication licensing factor MCM7",
"description": [
"Acts as component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity"
],
"length": 208,
"sequence": "VKPAVQINAYTCDRCGCEVFQPITTKQFIPMTECFSEECTKNNSKGQLFLSTRASKFVPFQEVKIQEMADQVPVGHIPRTLTVHCHGSLTRQLNPGDVVDIAGIFLPIPYTGFRAIRAGLLTDTYLEAQHVTQHKKAYNDLVMDSRTLRKIEQHLSSGNMYEYLARSIAPEIYGHLDVKKALLLLLIGGVTKEMGDGMHIRGDINICL",
"proteome": null,
"gene": "MCM7",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003678",
"name": "DNA helicase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006270",
"name": "DNA replication initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042555",
"name": "MCM complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c4da101550b82c589ed0a28ad40713455d60288f",
"counters": {
"domain_architectures": 4804,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"ssf": 1,
"smart": 1,
"cathgene3d": 2,
"profile": 1,
"panther": 1,
"prints": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4804
}
}
}