GET /api/protein/UniProt/D5HJR4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D5HJR4",
        "id": "D5HJR4_BCHK3",
        "source_organism": {
            "taxId": "742002",
            "scientificName": "Bat SARS coronavirus HKU3-5",
            "fullName": "Bat SARS coronavirus HKU3-5"
        },
        "name": "Envelope small membrane protein",
        "description": [
            "Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis"
        ],
        "length": 76,
        "sequence": "MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV",
        "proteome": null,
        "gene": "E",
        "go_terms": [
            {
                "identifier": "GO:0019068",
                "name": "virion assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046760",
                "name": "viral budding from Golgi membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "fe089b24b8342db75b5f45561e57c179de583659",
        "counters": {
            "domain_architectures": 981,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 981
        }
    }
}