GET /api/protein/UniProt/D5EL88/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D5EL88",
        "id": "D5EL88_CORAD",
        "source_organism": {
            "taxId": "583355",
            "scientificName": "Coraliomargarita akajimensis (strain DSM 45221 / IAM 15411 / JCM 23193 / KCTC 12865 / 04OKA010-24)",
            "fullName": "Coraliomargarita akajimensis (strain DSM 45221 / IAM 15411 / JCM 23193 / KCTC 12865 / 04OKA010-24)"
        },
        "name": "Arginine biosynthesis bifunctional protein ArgJ",
        "description": [
            "Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate"
        ],
        "length": 411,
        "sequence": "MNESITVNLIENPGGLADCPGYQIAGVACDVRETGDLERLDMALFTSEEPCSAAGVFTLNDVCAAPVKLCKAILARSGDKIAGCVSNSGNANAATGEQGMKDAKQMSTVAQLETGIGAPFLVCSTGRIGRKLPMQKIEAGIGAAAKALSAETEASLNAADAILTSDTRRKVATAQFEFSGKAITVSGMAKGAGMIEPNMATMLAYVVTDLEANNTLLQAVLKEACDKTFNCISVDGDMSTNDTVLLFANGRSGIQADASPELLAAFKDAVYQVCDIMAEKIVGDGEKVTKLVELTVKGCQSNEDAEKVARAVGNSLLVKTSWYGSDPNWGRLADAAGYARVGLDETCFDIHYDDCPALIAGRPQDERLQKWKDIVSKNRFRITLNLNQGEGRFRLLTSDLSEAYVDFNKSE",
        "proteome": "UP000000925",
        "gene": "argJ",
        "go_terms": [
            {
                "identifier": "GO:0004358",
                "name": "L-glutamate N-acetyltransferase activity, acting on acetyl-L-ornithine as donor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006526",
                "name": "L-arginine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "786eedc3d667c9a65d4335fc8459a6c268e2b6f6",
        "counters": {
            "domain_architectures": 20269,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20269
        }
    }
}