General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D5CTE4",
        "id": "D5CTE4_SIDLE",
        "source_organism": {
            "taxId": "580332",
            "scientificName": "Sideroxydans lithotrophicus (strain ES-1)",
            "fullName": "Sideroxydans lithotrophicus (strain ES-1)"
        },
        "name": "Peptide deformylase",
        "description": [
            "Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions"
        ],
        "length": 167,
        "sequence": "MAILPIIQYPDERLHKVAKKVEQINEATRKLVRDMAETMYAAPGIGLAATQVDKHIRLIVIDVSETHDDLKVFINPELVDSMGDKENEEGCLSVPGIYEKVTRAEFVTVNALDEHGKPFTLNAEGLLAVCIQHEMDHLQGRVFVEKLSHLKQTRIRAKLKKQRRETL",
        "proteome": "UP000001625",
        "gene": "def",
        "go_terms": [
            {
                "identifier": "GO:0042586",
                "name": "peptide deformylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fa547ef24adbcac0a50b8b949cdd967c1ce8b23b",
        "counters": {
            "domain_architectures": 45842,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 45842
        }
    }
}