General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D4ZX35",
        "id": "MTAP_LIMP3",
        "source_organism": {
            "taxId": "696747",
            "scientificName": "Limnospira platensis (strain NIES-39 / UTEX 3086 / IAM M-135)",
            "fullName": "Limnospira platensis (strain NIES-39 / UTEX 3086 / IAM M-135)"
        },
        "name": "Type II methyltransferase M.AplI",
        "description": [
            "A methylase, recognizes the double-stranded sequence 5'-CTGCAG-3', methylates C-4 on both strands, and protects the DNA from cleavage by the AplI endonuclease"
        ],
        "length": 345,
        "sequence": "MSNRLSYWEYLHQELKLNADIQSQLVVLDLFAGCGGFSLGFKAAGFQTIGYEMLADAAATYTRNLQDPCYCQTLEIGQDLCNHPDVIIGGPPCQPFSVGGLQKGPRDSRDGLPIFIDAIARYQPEIAIFENVRGMLYKNRQYLEKIVAELERLNYRVDIKLINAVNYGVPQKRERLFVVAYQTAWNWPEAETLAIPYTAGDAIYDTASTIPIGAKFLTPSMLEYIGRYEAKSKCVKPRDIYLDIPCRTLTCRNLSGATSDMLRLLLPDGRRRRLTVREAARLQSFPDWFELVGSENSQFNQIGNAVPPLLAKAIAKSVKMTLENKPSRPTDYFSPFPQQLKLPFA",
        "proteome": null,
        "gene": "aplIM",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e6a7ccc0f7524dbb3977a0f69beafc1c41f1e2aa",
        "counters": {
            "domain_architectures": 33938,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33938
        }
    }
}