GET /api/protein/UniProt/D4INS8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D4INS8",
        "id": "D4INS8_9BACT",
        "source_organism": {
            "taxId": "717959",
            "scientificName": "Alistipes shahii WAL 8301",
            "fullName": "Alistipes shahii WAL 8301"
        },
        "name": "Superoxide dismutase",
        "description": [
            "Destroys radicals which are normally produced within the cells and which are toxic to biological systems"
        ],
        "length": 203,
        "sequence": "MATTDTASSPRFTPQDLPYAYDALAPAISEETMHYHHDKHYAGYVDKLNELIVDTPFAGQPLEDIILSADGPVYNNAAQAWNHAFFFGQLSPKPQKEPSGELLEAINRNFGSLDELKVQIGRAAAGLFGSGWVWLAEDPSGRLAVVSEQNAGNPMRHGMKPLLAIDVWEHAYYIDYRNRRADAVEALWGVVDWKVVGDRYAEK",
        "proteome": "UP000008794",
        "gene": "AL1_23370",
        "go_terms": [
            {
                "identifier": "GO:0004784",
                "name": "superoxide dismutase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006801",
                "name": "superoxide metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd6207aea5eb2a91ae628a69adfab9df8e89ed4f",
        "counters": {
            "domain_architectures": 39182,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 39182
        }
    }
}