General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D4DQD7",
        "id": "D4DQD7_NEIEG",
        "source_organism": {
            "taxId": "546263",
            "scientificName": "Neisseria elongata subsp. glycolytica ATCC 29315",
            "fullName": "Neisseria elongata subsp. glycolytica ATCC 29315"
        },
        "name": "5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase",
        "description": [
            "Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively. Also cleaves 5'-deoxyadenosine, a toxic by-product of radical S-adenosylmethionine (SAM) enzymes, into 5-deoxyribose and adenine"
        ],
        "length": 234,
        "sequence": "MNTIRTIAVIGAMQPEIELLKGRLNNCESHRFGAFEIHCGELHGKRIVLTLSGIGKVNAAAATATAILKFSPDCVINTGSAGGLAQGLKVGDVVIGSETAHHDVDVTAFGYAIGQVPQLPPAFASDHALVTAAERAAAAFPNAAVRRGLIVSGDRFVHSSEAVAAIRKNFPDVQAVEMEAAAIAQTCAQFSLPFVVIRAVSDAADEKADVSFEKFLQTAAVHSAEMVDGMIREL",
        "proteome": "UP000031392",
        "gene": "mtnN",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009116",
                "name": "nucleoside metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008782",
                "name": "adenosylhomocysteine nucleosidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008930",
                "name": "methylthioadenosine nucleosidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009164",
                "name": "nucleoside catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019509",
                "name": "L-methionine salvage from methylthioadenosine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "27552274e8941821ae0d138350daef5fe3adde72",
        "counters": {
            "domain_architectures": 85785,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 85785
        }
    }
}