GET /api/protein/UniProt/D4DAF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D4DAF4",
        "id": "D4DAF4_TRIVH",
        "source_organism": {
            "taxId": "663202",
            "scientificName": "Trichophyton verrucosum (strain HKI 0517)",
            "fullName": "Trichophyton verrucosum (strain HKI 0517)"
        },
        "name": "Proteasome subunit beta",
        "description": [
            "Component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity"
        ],
        "length": 281,
        "sequence": "MDTLVAQYSRPSSFQDDYEAEQQDVLERAPPLSLRFSLPPIDRPSAFLRATTDDHANPDCKIAHGTTTLAFRFQGGIIVATDSRATAGNWIASQTVKKVIEINSCLLGTMAGGAADCQYWLAYLGMQCRLHELRHKRRISVAAASKILANLVYNYKGMGLSMGTMCAGVTPEEGPALYYIDSDGTRLPGNLFCVGSGQTFAYGVLDAEYRYDLTEEEALALGSRSILAATHRDAYSGGFINLYHVKEDGWVKHGFSDTNPIFWNTKLEKGEFSNVSENIVN",
        "proteome": "UP000008383",
        "gene": "TRV_04101",
        "go_terms": [
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005839",
                "name": "proteasome core complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004298",
                "name": "threonine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0cadb4b1c9d733ad28db3ac45300c7c0dc1b432",
        "counters": {
            "domain_architectures": 65712,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 65712
        }
    }
}