GET /api/protein/UniProt/D4A565/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D4A565",
        "id": "D4A565_RAT",
        "source_organism": {
            "taxId": "10116",
            "scientificName": "Rattus norvegicus",
            "fullName": "Rattus norvegicus (Rat)"
        },
        "name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial",
        "description": [
            "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 231,
        "sequence": "MKLASTRRCPHSTWPSRHSPSLVDCPSRLPLPTLLPSVAVVAMAAMSLLQRASVAALTALSGRRAGTRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVIKPSLYYDARFLRLMKFYLLLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARTFYDGPEKNYEKTLAILQIESEKADLRLKELEVRRLMRARGDGPWYQYPTPEKEFIDYSPKSTPDN",
        "proteome": "UP000002494",
        "gene": "Ndufb5",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "76403b4fe60ff5d5267a2a2bbf7b2f37f785b8bc",
        "counters": {
            "domain_architectures": 1670,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1670
        }
    }
}